PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA218G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 136aa    MW: 15582.5 Da    PI: 7.4403
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA218G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB162.37e-51397397
        NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 ++d++lPianv+rimk++lP+nakisk+ak+tvqec++efisfvt+easdkc+re+rkt+ngdd++wal+tlG+++y++++  +l+kyre+e+e+
  AA218G00001  3 DEDKLLPIANVGRIMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENRKTVNGDDIWWALSTLGLDNYADAVGRHLHKYREAEKER 97
                 79******************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-472120IPR009072Histone-fold
SuperFamilySSF471136.21E-394123IPR009072Histone-fold
PfamPF008082.4E-26871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.6E-163553No hitNo description
PROSITE patternPS0068503854IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.6E-165472No hitNo description
PRINTSPR006153.6E-167391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MGDEDKLLPI ANVGRIMKQI LPSNAKISKE AKQTVQECAT EFISFVTCEA SDKCHRENRK  60
TVNGDDIWWA LSTLGLDNYA DAVGRHLHKY REAEKERIEI NKNINDSENE KEPENRSKRN  120
RVFEKGSSSL AYLNKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-39192192Transcription factor HapC (Eurofung)
4g92_B3e-39192192Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148158.13e-78PREDICTED: nuclear transcription factor Y subunit B-4
RefseqXP_013646457.13e-78PREDICTED: nuclear transcription factor Y subunit B-4-like
RefseqXP_013710807.13e-78PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040275e-78NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLM4DPZ43e-78M4DPZ4_BRARP; Uncharacterized protein
STRINGBra018585.1-P9e-78(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.13e-79nuclear factor Y, subunit B4